PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589042.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 266aa    MW: 31242.5 Da    PI: 9.6467
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589042.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.82.8e-192370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ll+++vk +G g+W+++ar  g++R +k+c++rw +yl
   XP_009589042.1 23 KGPWTAEEDKLLIEYVKSHGEGRWNSVARLTGLKRNGKSCRLRWVNYL 70
                     79******************************9*************97 PP

2Myb_DNA-binding52.79.7e-1776120147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
   XP_009589042.1  76 RGQITPHEERIILELHAKWGNR-WSTIARSLP-GRTDNEIKNYWRTH 120
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.1851870IPR017930Myb domain
SuperFamilySSF466894.67E-3120117IPR009057Homeodomain-like
SMARTSM007171.0E-162272IPR001005SANT/Myb domain
PfamPF002491.2E-172370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-242477IPR009057Homeodomain-like
CDDcd001671.44E-112570No hitNo description
PROSITE profilePS5129425.02571125IPR017930Myb domain
SMARTSM007171.9E-1575123IPR001005SANT/Myb domain
PfamPF002494.1E-1476120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2478124IPR009057Homeodomain-like
CDDcd001672.34E-1080121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MLCEIMSSEQ MGNWGILEEG WRKGPWTAEE DKLLIEYVKS HGEGRWNSVA RLTGLKRNGK  60
SCRLRWVNYL RPDLKRGQIT PHEERIILEL HAKWGNRWST IARSLPGRTD NEIKNYWRTH  120
FKKKTKNSCA NSEKSRARLW KKQHFLQQQQ LQQQQQINNQ IDIKKVMSLF DPNENKVPTM  180
PQAKQEMTIL YPRTVDQQNQ VGFFYSMLNS CSSVSVPEPS SNEDIMWDGL WNLDDFYGQF  240
INTTTYNKTI TTPNCLQTMA TTPAFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-282312527128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754486e-41HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755216e-41HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589042.10.0PREDICTED: myb-related protein 305
TrEMBLM0ZMC01e-122M0ZMC0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000037961e-122(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.11e-77myb domain protein 79